DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eater and Dkk1

DIOPT Version :9

Sequence 1:NP_651533.3 Gene:eater / 43262 FlyBaseID:FBgn0243514 Length:1074 Species:Drosophila melanogaster
Sequence 2:NP_001099820.1 Gene:Dkk1 / 293897 RGDID:1307313 Length:270 Species:Rattus norvegicus


Alignment Length:230 Identity:56/230 - (24%)
Similarity:89/230 - (38%) Gaps:64/230 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   456 ENRCSPVCSGGCKNG--FCVAPGKCSCDEGYSK-ETGNSCKPI-CSKGCENG---FCDAPEKCSC 513
            :|...|:...|.:.|  ..||||...  ||.:| :|.::.:|. |::..|.|   :|.:|.:.:.
  Rat    44 KNLPPPLGGAGGQPGSAVSVAPGVLY--EGGNKYQTLDNYQPYPCAEDEECGTDEYCSSPSRGAA 106

  Fly   514 NDGYEMDG----------ENRC---SPVCSGG-CKNGFCVAPE-----KCSCDEGYSKETGNSCK 559
            ..|    |          ..||   :..|.|. ||||.|:..:     :...:||..:..||   
  Rat   107 GVG----GVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHLPRGEIEEGIIENLGN--- 164

  Fly   560 PICSNGCENGFCDAPEKCSCNDG-YEMDGENRCSPVC--SGGCKNGFCVAPGKCSCDEGYSKETG 621
               .:|..:|:   |.:.:.... |...|:.  ..||  |..|..|.|.|      ...:||   
  Rat   165 ---DHGAGDGY---PRRTTLTSKIYHTKGQE--GSVCLRSSDCATGLCCA------RHFWSK--- 212

  Fly   622 NSCKP------ICSKGCENGF--CDAPEKCSCNDG 648
             .|||      :|:|....|.  .:..::|.|.:|
  Rat   213 -ICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEG 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaterNP_651533.3 None
Dkk1NP_001099820.1 Dickkopf_N 86..142 CDD:398399 15/59 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.