DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eater and Scarf2

DIOPT Version :9

Sequence 1:NP_651533.3 Gene:eater / 43262 FlyBaseID:FBgn0243514 Length:1074 Species:Drosophila melanogaster
Sequence 2:XP_038944006.1 Gene:Scarf2 / 287949 RGDID:1306013 Length:838 Species:Rattus norvegicus


Alignment Length:522 Identity:139/522 - (26%)
Similarity:187/522 - (35%) Gaps:174/522 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 CTAP--DVCQCLTGYTKIGHNVCLAVCPEG---C-QNGVCVAPNECSCNAGY--TKLEGVCT--- 295
            |..|  .|..|..|:.::|....:||| ||   | :|.|||.|.||.|..||  ...:..|.   
  Rat    46 CRTPGSQVLTCCAGWRQLGDECGIAVC-EGNSTCSENEVCVRPGECRCRHGYFGANCDTKCPRQF 109

  Fly   296 --PVCKDGCVNGFCASPEKCSCNDGYEMDSENRCSPVCSGGCKNGFCVAPGKCSCDEGYIKGTGN 358
              |.||           |:|||:.              .|.|::    ..|:|:|   :.:..|.
  Rat   110 WGPDCK-----------ERCSCHP--------------HGQCED----VTGQCTC---HARRWGA 142

  Fly   359 SCKPICSKGCENGFCDAPEKCSCNDGYEMDGENRCSP-----VCSGGCKNGFCVA-------PGK 411
            .|:..|.  |::|.|. |...:|          ||.|     .|:..|   :|.|       .|.
  Rat   143 RCEHACQ--CQHGTCH-PRSGAC----------RCEPGWWGAQCASAC---YCSATSRCDPQTGA 191

  Fly   412 CSCDEGYSKETGNSCKPICSKGCENGFCDAPE-KCSCNDGYEMDSENRCSPVCSGGCKNGFC-VA 474
            |.|..|:   .|.||...||  |.:..|:... :|.|.   |.....||...|.  |..|.| ..
  Rat   192 CLCHAGW---WGRSCNNQCS--CNSSPCEQQSGRCQCR---ERTFGARCDRYCQ--CFRGRCHPV 246

  Fly   475 PGKCSCDEGYSKETGNSCKPICSKGCENGFCDAPEKCSCNDGYEMDGENRCSPVCSGGCKNGFCV 539
            .|.|:||.||..:       .|.:.|..||            |.:....||          |.|.
  Rat   247 DGTCACDPGYRGK-------YCREPCPAGF------------YGLGCRRRC----------GQCK 282

  Fly   540 APEKCSCDEGYSKETGNSCKPICSNGCENGFCDAPEKCSCNDGYEMDG-ENRCSPVCSGGCKNGF 603
            ..:.|:..||...    :|:|    |.....||.|    |..|:..:| .:||.|     |::|.
  Rat   283 GQQPCTVVEGRCL----TCEP----GWNGTKCDQP----CATGFYGEGCGHRCPP-----CRDGH 330

  Fly   604 CV--APGKCS-CDEGYSKETGNSCKPICSKGCENGFCDAPEKCSCNDGYEMDSENRCSPVCSGGC 665
            ..  ..|||: |:.|:   .|:.|:..||.|.                |..|    |:.||| .|
  Rat   331 ACNHVTGKCTHCNAGW---IGDRCETKCSNGT----------------YGED----CAFVCS-DC 371

  Fly   666 KNGFC-IAPGKCSCDEGYSKETGNSCKPICSKGCENGFCDAPEKCSCNDGYEMDSENRCSPVCSG 729
            .:|.| ...|:|.|..|..   |..|...|..|...  .|..:.|||:       |..|.|| :|
  Rat   372 GSGHCDFQSGRCLCSPGVH---GPHCNVTCPAGLHG--VDCAQACSCH-------EESCDPV-TG 423

  Fly   730 GC 731
            .|
  Rat   424 AC 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaterNP_651533.3 None
Scarf2XP_038944006.1 exchanger_TraA <74..431 CDD:411343 129/493 (26%)
PHA03247 <683..837 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.