DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eater and Tnr

DIOPT Version :9

Sequence 1:NP_651533.3 Gene:eater / 43262 FlyBaseID:FBgn0243514 Length:1074 Species:Drosophila melanogaster
Sequence 2:NP_037177.2 Gene:Tnr / 25567 RGDID:3886 Length:1358 Species:Rattus norvegicus


Alignment Length:312 Identity:88/312 - (28%)
Similarity:114/312 - (36%) Gaps:110/312 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   495 ICSKGCENGFCDAPEKCSCND-------GYEMDGENRCS-------PVCSGGCKNGFCVAPEKCS 545
            :||.|.|   ..|.:..|..|       |...|.|::.:       |..:..|.:...|..|..|
  Rat    78 LCSSGLE---ASAEQDVSAEDDTLAEYTGQTSDHESQVTFTHKINLPKKACPCASSAQVLQELLS 139

  Fly   546 CDEGYSKETG--------NSCK-----------PICSNGCENGF--CDAPEKCSCNDGYEMDGEN 589
            ..|...:|..        |.|:           |.||......|  |.    |.||:|:  .|:|
  Rat   140 RIEMLEREVSVLRDQCNTNCCQESAATGQLDYVPHCSGHGNFSFESCG----CICNEGW--FGKN 198

  Fly   590 RCSPVCSGGCKN-GFCVAPGKCSCDEGYSKETGNSCKPICSKGCENGFCDAPEKCSCNDGYEMDS 653
            ...|.|..||.: |.|| .|:|.||..||   |:.|                            |
  Rat   199 CSEPYCPLGCSSRGVCV-DGQCICDSEYS---GDDC----------------------------S 231

  Fly   654 ENRCSPVCSGGCKNGFCIAPGKCSCDEGYSKETGNSCKPI-----CS-KG-CENGFCDAPEKCSC 711
            |.||...||   ..|.|: .|:|.|:|.|   ||..|:.:     || || |.||      .|.|
  Rat   232 ELRCPTDCS---SRGLCV-DGECVCEEPY---TGEDCRELRCPGDCSGKGQCANG------TCLC 283

  Fly   712 NDGY--EMDSENRCSPVCS--GGCKNGFCVAPGKCSCDEGYSKETGNSCKPI 759
            .:||  |..|:.||...||  |.|:.|.|:      |:|||.   |..|..:
  Rat   284 QEGYAGEDCSQRRCLNACSGRGHCQEGLCI------CEEGYQ---GPDCSAV 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaterNP_651533.3 None
TnrNP_037177.2 exchanger_TraA <190..>328 CDD:411343 63/193 (33%)
EGF_Tenascin 203..231 CDD:376143 14/59 (24%)
fn3 328..398 CDD:394996
fn3 416..496 CDD:394996
fn3 507..586 CDD:394996
FN3 595..679 CDD:238020
fn3 687..766 CDD:394996
fn3 776..855 CDD:394996
fn3 865..944 CDD:394996
fn3 954..1026 CDD:394996
FN3 1042..1127 CDD:238020
FReD 1134..1342 CDD:238040
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.