DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eater and Vegfc

DIOPT Version :9

Sequence 1:NP_651533.3 Gene:eater / 43262 FlyBaseID:FBgn0243514 Length:1074 Species:Drosophila melanogaster
Sequence 2:NP_033532.1 Gene:Vegfc / 22341 MGIID:109124 Length:415 Species:Mus musculus


Alignment Length:323 Identity:79/323 - (24%)
Similarity:106/323 - (32%) Gaps:94/323 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 CVPY--CKGCSRGTCQSPG-RCICSARHLLDKTTNNCIPQCASGCPNGTCITPNNCSCNKGYKLN 152
            ||..  |.||    |.|.| :|:.::...|.||........:.|....|....|:.||....||:
Mouse   152 CVSVYRCGGC----CNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLD 212

  Fly   153 PTTQV------CLPTCKDNCAAVNGFCAAPNR-------CECNPGFIPKPKSKSFECQPKCKNGC 204
            ...||      .||.....|.|.|..|  |..       |.|       ...:.|......::..
Mouse   213 VYRQVHSIIRRSLPATLPQCQAANKTC--PTNYVWNNYMCRC-------LAQQDFIFYSNVEDDS 268

  Fly   205 SNGVCRAPDKCECNKFYEKDIDGNCVPICENGCVNGNCTAP------DVCQCLTGYTKIGHNVCL 263
            :||.   .|.|..||..::|   .|..:|:.|....:| .|      |.|||:            
Mouse   269 TNGF---HDVCGPNKELDED---TCQCVCKGGLRPSSC-GPHKELDRDSCQCV------------ 314

  Fly   264 AVCPEGCQNGVCVAPNECSCNAGYTKLEGVCTPVCKDGCVNGFCASPEKCSCNDGYEMDSENRCS 328
                  |:|.  :.||.|..|..:.  |..|..|||..|......:|.||:|.            
Mouse   315 ------CKNK--LFPNSCGANREFD--ENTCQCVCKRTCPRNQPLNPGKCACE------------ 357

  Fly   329 PVCSGGCKNGFCVAPGK------CSCDEGYIKGTGNSCKPICSKGCENGFCDAPEKCSCNDGY 385
              |:...:.  |...||      |||   |.:...|..     |.|:.|...:.|.|.|...|
Mouse   358 --CTENTQK--CFLKGKKFHHQTCSC---YRRPCANRL-----KHCDPGLSFSEEVCRCVPSY 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaterNP_651533.3 None
VegfcNP_033532.1 PDGF 127..207 CDD:278756 17/58 (29%)
4 X 16 AA repeats of C-X(10)-C-X-C-X(1,3)-C 276..358 29/121 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.