powered by:
Protein Alignment eater and sdz-23
DIOPT Version :9
Sequence 1: | NP_651533.3 |
Gene: | eater / 43262 |
FlyBaseID: | FBgn0243514 |
Length: | 1074 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_505091.1 |
Gene: | sdz-23 / 186544 |
WormBaseID: | WBGene00019066 |
Length: | 267 |
Species: | Caenorhabditis elegans |
Alignment Length: | 60 |
Identity: | 20/60 - (33%) |
Similarity: | 24/60 - (40%) |
Gaps: | 10/60 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 525 CSPVCSGGCKNGFCVAPEKCSCDEGYSKETGNSC-KPICSNGCENGFCDAPEKCSCNDGY 583
|.|...|.....:|.:.||||.|| | |..|.|..:..|..:..||.|..||
Worm 131 CLPSFYGPKCQYYCTSGEKCSRDE---------CPKRKCQNNSQCQFDGSESKCVCQSGY 181
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1218 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.