DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eater and Vegfd

DIOPT Version :9

Sequence 1:NP_651533.3 Gene:eater / 43262 FlyBaseID:FBgn0243514 Length:1074 Species:Drosophila melanogaster
Sequence 2:NP_034346.1 Gene:Vegfd / 14205 MGIID:108037 Length:358 Species:Mus musculus


Alignment Length:295 Identity:63/295 - (21%)
Similarity:84/295 - (28%) Gaps:118/295 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 LAVCPEGCQNGVCVAPNECSCNAGYTKLEGVCTPVCKDGCVN----GFCASPEKCSCND------ 317
            |.|..|..|...| :|.| :|....::|........|..|||    |.|.:.|...|.:      
Mouse   104 LKVIDEEWQRTQC-SPRE-TCVEVASELGKTTNTFFKPPCVNVFRCGGCCNEEGVMCMNTSTSYI 166

  Fly   318 -------GYEMDSENRCSPVCSG---GCKNGFCVAPG---------------------------- 344
                   ...:.|.....||...   |||   |:..|                            
Mouse   167 SKQLFEISVPLTSVPELVPVKIANHTGCK---CLPTGPRHPYSIIRRSIQTPEEDECPHSKKLCP 228

  Fly   345 --------KCSC---DEGYIKGTGNSCKPICSKGCENGFCDAPEKCSCNDGYEMDGENRCSPVCS 398
                    ||.|   ||..:.||.           ::.:...|..|..:..::   |:||..||.
Mouse   229 IDMLWDNTKCKCVLQDETPLPGTE-----------DHSYLQEPTLCGPHMTFD---EDRCECVCK 279

  Fly   399 GGCKNGFCVAPGKCSCDEGYSKETGNSCKPICSKGCENGFCDAPEKCSCNDGYEMDSENRCSPVC 463
            ..|.......|..|||.|  .||:..||       |:......|:.|||        |:||.   
Mouse   280 APCPGDLIQHPENCSCFE--CKESLESC-------CQKHKIFHPDTCSC--------EDRCP--- 324

  Fly   464 SGGCKNGFCVAPGKCSCDEGYSKETGNSCKPICSK 498
                                :...|..|.||.|.|
Mouse   325 --------------------FHTRTCASRKPACGK 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaterNP_651533.3 None
VegfdNP_034346.1 PDGF 114..198 CDD:197537 20/88 (23%)
4 X 16 AA repeats of C-X(10)-C-X-C-X(1,3)-C 227..323 30/126 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.