DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eater and dkk3b

DIOPT Version :9

Sequence 1:NP_651533.3 Gene:eater / 43262 FlyBaseID:FBgn0243514 Length:1074 Species:Drosophila melanogaster
Sequence 2:NP_001083014.1 Gene:dkk3b / 100038765 ZFINID:ZDB-GENE-061207-74 Length:283 Species:Danio rerio


Alignment Length:179 Identity:39/179 - (21%)
Similarity:61/179 - (34%) Gaps:71/179 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   873 KCSCDEGYSKETEISCAPFCKDGCVNGLCVSPDFCKCDDGYIFVEESKSCQLDKELLGDYSDCDK 937
            :|..||.            |.||         .||..:   |...:...||...      .:|.|
Zfish   136 ECMIDED------------CGDG---------SFCLYE---IVTSKCVPCQTTN------MECTK 170

  Fly   938 N---CRNGTCVEGIC----TCSKQYKLHRNEDD---------NNLICLPICEPECLNGL-CEFPG 985
            :   |.:..||.|:|    |..:...:.:|::|         :..:..|:|.|:...|. ||..|
Zfish   171 DVECCGDQLCVWGVCAQNKTKGQSGTICQNQNDCSPQHCCAFHKALLFPVCRPKPQEGQGCEREG 235

  Fly   986 S----CVCWDGESPID------GYSCQSMDSLGSLTGHEKS-----ERH 1019
            :    .:.|:.|.|.:      |..||.:         :||     |||
Zfish   236 NQLMEVLLWEDEGPREHCPCAAGLLCQQI---------QKSSVCVDERH 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaterNP_651533.3 None
dkk3bNP_001083014.1 Dickkopf_N 137..186 CDD:282549 17/78 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.