DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14259 and to

DIOPT Version :9

Sequence 1:NP_651532.1 Gene:CG14259 / 43261 FlyBaseID:FBgn0039483 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001287525.1 Gene:to / 43036 FlyBaseID:FBgn0039298 Length:249 Species:Drosophila melanogaster


Alignment Length:266 Identity:69/266 - (25%)
Similarity:118/266 - (44%) Gaps:40/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ILCLNEIAMDRSLVSAVAYYSEKPAFLPSCRIYEPGFTKCSTNSIQKLLDQL-----NIGIPEVL 79
            :|||        |||..|.:.|.|   ..|: |..|  :|    |.||.:.|     ..|.|.: 
  Fly     9 VLCL--------LVSVDAKFPEDP---KPCK-YGDG--EC----IMKLCNTLFSENSAEGDPGL- 54

  Fly    80 ERFGPFDPMRVRDIVFKQ-DNNEVATIRANLTDLVVKGFANTKVKESRVSK-KDF------SWQT 136
             .....||::|..:|..| :::....|....||.::.|     :|:.|:.| |.|      ..:.
  Fly    55 -NLMQLDPLKVDRMVISQGESSSPVGITLTFTDNLLYG-----IKDQRIVKVKGFGRDLTAKHEV 113

  Fly   137 KIYLPKMRLDGRYEMAGRILLIPLSGSGKIFIEIDDLDILLLTKIRLYEKGGFTFDNVTAVQVQL 201
            ||......|.|.|.:.|::|::|:||:|:..:.:.::..::....:...|.|.|:.:||.:::.:
  Fly   114 KIVTKTFSLVGPYNIQGKVLILPISGTGQSNMTMVNVRAIVSFSGKPLVKNGETYLDVTDLKITM 178

  Fly   202 NLSKVRTYLDNLFNGRSKEVERSTNEFFNENWRDFYEALKPLIVETVENILYDVMSTVFHLIP-A 265
            .......:..||||| .|.:..:.|.|.|||....|:.....|..:...:...|:..||..:| |
  Fly   179 KPESSHYHFSNLFNG-DKALGDNMNVFLNENSEAIYKETAKAIDRSFGKLYLGVVKGVFSKLPYA 242

  Fly   266 NFFVED 271
            .||.::
  Fly   243 KFFADE 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14259NP_651532.1 JHBP 32..269 CDD:284096 65/250 (26%)
toNP_001287525.1 JHBP 5..245 CDD:284096 67/261 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470365
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.