DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14259 and CG13618

DIOPT Version :9

Sequence 1:NP_651532.1 Gene:CG14259 / 43261 FlyBaseID:FBgn0039483 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_651265.1 Gene:CG13618 / 42924 FlyBaseID:FBgn0039203 Length:252 Species:Drosophila melanogaster


Alignment Length:276 Identity:74/276 - (26%)
Similarity:126/276 - (45%) Gaps:48/276 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 WSGLLAILCLNEIAMDRSLVSAVAYYSEKPAFLPSCRIYEPGFTKCSTNSIQKLLDQLNIGIPEV 78
            :|.||.:|.:..:|.:.::.:|    .|.|...|.|: .:..|.||..:::...:.||..|..| 
  Fly     4 YSLLLMLLLIAAVAQELTVTAA----QELPEGFPKCK-RDANFDKCLVDAVNVAIQQLKAGNRE- 62

  Fly    79 LERFG--PFDPMRVRDIVFKQDNNEVATIRANLTDLVVKGFANT-KVKESRV----------SKK 130
               ||  |.:|:.|:.:|....|..: .:|..|.::.|....:| |::..|.          |:.
  Fly    63 ---FGIPPLEPLTVKKLVIDAGNAPI-NLRQALKNVKVHDMISTSKIQRYRTDLDKHLIICDSRT 123

  Fly   131 DFSWQTKIYLPKMRLDGRYEMAGRILLIPLSGSGKIFIEIDDLDILLLTKI--RL----YEKGGF 189
            |          ::.:.|.|||:|||||:|::|.||..:      .|:.|||  ||    :||.|.
  Fly   124 D----------RIEMIGDYEMSGRILLLPITGHGKANV------TLINTKIEHRLIGEPFEKDGV 172

  Fly   190 TFDNVTAVQVQLNLSKVRTYLDNLFNGRSKEVERSTNEFFNENWRDFYEALKPLIVETVENILYD 254
            .:..:...:|..:..:|....:||||  .|.:....|.|.||||...:..||....::...|..:
  Fly   173 KYMRLKDYRVSFDPKRVYMNFENLFN--DKTLSDGMNRFLNENWETVFNELKVGYAKSFGIIFRE 235

  Fly   255 VMSTVFHLIP-ANFFV 269
            :.:.:|..:| .|.|:
  Fly   236 LSNKLFEKVPFDNIFL 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14259NP_651532.1 JHBP 32..269 CDD:284096 68/256 (27%)
CG13618NP_651265.1 JHBP 13..251 CDD:284096 69/265 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470390
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.