DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14259 and CG15497

DIOPT Version :9

Sequence 1:NP_651532.1 Gene:CG14259 / 43261 FlyBaseID:FBgn0039483 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_650976.1 Gene:CG15497 / 42552 FlyBaseID:FBgn0038894 Length:260 Species:Drosophila melanogaster


Alignment Length:226 Identity:46/226 - (20%)
Similarity:92/226 - (40%) Gaps:12/226 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LPSCRIYEPGFTKCSTNSIQKLLDQLNIGIPEVLERFGPFDPMRVRDIVFKQDNNE-VATIRANL 109
            |..|...:..|.:|.......|......|:|:.  ...||||.....:..::..:: :.:.|..|
  Fly    43 LGRCHWSDEDFNECMRQVFNDLRAYFTTGVPDY--NIKPFDPHHCSYVELRRGESQGLGSFRLIL 105

  Fly   110 TDLVVKGFANTKVKESRVSKKDFSWQTKIYLPKMRLDGRYEMAGRILLIPLSGSGKIFIEIDDLD 174
            .::...|:|.::|.:.....:|.......|.|...|:|.||.|.::|...::..|...:.:  .|
  Fly   106 RNVSEYGWARSEVTKFHADPEDQRIVYTQYFPDKSLEGEYEFAAKMLGTEMNRKGHWNLTL--YD 168

  Fly   175 ILLLTKIRLYEKGGFTFDNVTAVQVQLN-LSKVRTYLDNLFNGRSKEVERSTNEFFNENWRDFYE 238
            ....|.:|.....|    ::..|.|::: :..:..:::||..|  :.:.:..:...|..|:....
  Fly   169 YSQTTSVRRIGGPG----SLIKVHVEVDRIGGMELHIENLLQG--QPLNQLADGVINSMWQLGLP 227

  Fly   239 ALKPLIVETVENILYDVMSTVFHLIPANFFV 269
            .:||:|.|.|.....|:.:..|...|...|:
  Fly   228 FIKPMINELVSTAFTDIFNESFRHFPLEKFL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14259NP_651532.1 JHBP 32..269 CDD:284096 45/224 (20%)
CG15497NP_650976.1 JHBP 26..258 CDD:284096 45/224 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470574
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.