DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14259 and CG17279

DIOPT Version :9

Sequence 1:NP_651532.1 Gene:CG14259 / 43261 FlyBaseID:FBgn0039483 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_650937.3 Gene:CG17279 / 42489 FlyBaseID:FBgn0038850 Length:245 Species:Drosophila melanogaster


Alignment Length:238 Identity:55/238 - (23%)
Similarity:114/238 - (47%) Gaps:21/238 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PAFLPSCRIYEPGFTKCSTNSIQKLLDQLNIGIPEV----LERFGPFDPMRVRDIVFKQDNNEVA 103
            |..:..||   .|.:.|...::.::|.....|:|.:    |:..| |:.:    :|.:.:.:..:
  Fly    20 PPEIEKCR---AGDSICIAETVTRILRLYPKGLPSIGLVALDSIG-FEDV----VVSRLEPDGSS 76

  Fly   104 TIRANLTDLVVKGFANTKVKESRVSKKDFSWQTKI--YLPKMRLDGRYEMAGRILLIPLSGSGKI 166
            |......:|.|.|||::.|.|::....|.....::  ::|.::|:|.|||.|.:|.:|:.|.|:.
  Fly    77 TFDLKFPNLTVIGFADSTVTEAKGFDADLPRVLELSGWIPLLKLNGTYEMRGSLLTMPIHGKGQA 141

  Fly   167 FIEIDDLDILLLTKIRLYE---KGGFTFDNVTAVQVQLNLSKVRTYLDNLFNGRSKEVERSTNEF 228
            .:||.:..:  ..|:|:.|   ..|..:..::.|:..|::..:...|:||||  :.|:..:.|..
  Fly   142 KVEIRECRV--RCKVRVLEDLRDDGKLYAGISKVKCLLDVQGMHLNLENLFN--NPEMSDAMNVV 202

  Fly   229 FNENWRDFYEALKPLIVETVENILYDVMSTVFHLIPANFFVED 271
            .|..|.:.:..|:..|...|:.::..::..|.:.:|.:....|
  Fly   203 ANTKWLEIWHNLRRGITSAVDQLVESILQRVANKLPYDDLYRD 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14259NP_651532.1 JHBP 32..269 CDD:284096 54/234 (23%)
CG17279NP_650937.3 JHBP 5..243 CDD:336447 54/234 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470380
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.