DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14259 and CG2016

DIOPT Version :9

Sequence 1:NP_651532.1 Gene:CG14259 / 43261 FlyBaseID:FBgn0039483 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001262270.1 Gene:CG2016 / 40612 FlyBaseID:FBgn0250839 Length:254 Species:Drosophila melanogaster


Alignment Length:251 Identity:53/251 - (21%)
Similarity:109/251 - (43%) Gaps:36/251 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 YYSEKPAFLPSCRIYEPGFTKCSTNSIQKLLDQLNIGIPEVLERFGPFDPMRVRDIVFKQDNNEV 102
            :..|:|.:|..|...|....:|...|..||:..|..|:||:       |...:..::.    :|:
  Fly    18 FAQEQPYYLQQCPRDEAQINECLRESGNKLVHYLQKGVPEL-------DIYEIEPVMI----DEI 71

  Fly   103 ATI--------RANLTDLVVKGFANTKVKESRVSKKDFSWQTKIYLPKMRLDGRYEMAGRILLIP 159
            ..:        ||...::...|.:|..|...|.......:|....:|::|:..:|...|.::|:.
  Fly    72 GIVLGSGPDGYRALFRNIQAYGVSNITVTNIRSDLDSLQFQLTCEIPRIRVKAQYRSTGVLILVK 136

  Fly   160 LSGSGKIFIEIDDLDILLLTKIRLYEKG-------GFTFDNVTAVQVQLNLSKVRTYLDNLFNGR 217
            .||:|..:.|.:.:      |.::|.|.       |.|:....:|::..|:.:::..:||:.||.
  Fly   137 ASGAGDYWGEYEGV------KAKIYFKAVANEGPDGRTYLTTDSVKMDFNVKEIQMGVDNIANGN 195

  Fly   218 S----KEVERSTNEFFNENWRDFYEALKPLIVETVENILYDVMSTVFHLIPANFFV 269
            :    ...|.:.|.|.|.|.::..:.:||.:...:..::.:.|..:|..||.:.::
  Fly   196 TVILLSSTEAALNLFINSNSQELLKEMKPALRTKLTLVIRNFMDRIFAKIPLDEWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14259NP_651532.1 JHBP 32..269 CDD:284096 53/249 (21%)
CG2016NP_001262270.1 JHBP 7..251 CDD:284096 53/249 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470457
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.