DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14259 and CG14661

DIOPT Version :9

Sequence 1:NP_651532.1 Gene:CG14259 / 43261 FlyBaseID:FBgn0039483 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001246918.1 Gene:CG14661 / 40611 FlyBaseID:FBgn0037288 Length:246 Species:Drosophila melanogaster


Alignment Length:262 Identity:67/262 - (25%)
Similarity:111/262 - (42%) Gaps:60/262 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LVSAVAYYS--EKPAFLPSCRIYEPGFTKCSTNSIQKLLDQLNIGIPEVLERFGPFDPMRVRDIV 94
            |:..||..|  ..|.::..|...:|..:||..:|:..|...|..||.|:  ...|.:|:.:.|:.
  Fly    11 LICFVACISAGNMPDYIQVCHRNDPELSKCLKSSVHNLRPYLAKGIKEL--NVPPLEPLYIGDLS 73

  Fly    95 FKQDNNEVATIRANLTDLVVKGFANTKVKESRVSKKDFSWQTKIYLPKMRLDGRYEMAGRILLIP 159
            . .|.:...|::|.  .|.:.|.:|.::.:.|.|.::..:..::.||.:..||.||:.|.||.:|
  Fly    74 I-LDGSAGLTVKAK--KLNILGASNFEITKLRASTQNRRFDFELILPHLHGDGLYEINGNILALP 135

  Fly   160 LSGSGKIFIEIDDLDILLLTKIRLYEKGGFTFDNVTAVQVQLNLS---------------KVRT- 208
            :.|:|..                   .|.|| :.|..|:||.::.               |:|| 
  Fly   136 IKGNGPF-------------------TGNFT-NFVAYVRVQYDIKSVNDLEYLHVKEFVLKIRTG 180

  Fly   209 ----YLDNLFNGRSKEVERSTNEFFNENWRDFYEAL----------KPLIVET--VENILYDVMS 257
                .|:||||| .|.:....|:..|:|:..|...|          |.|::.|  :||..|..:.
  Fly   181 KGNLKLENLFNG-DKVLGDVINDTINQNFEVFTNDLIAPIARALEAKFLVITTKILENFTYSELF 244

  Fly   258 TV 259
            .|
  Fly   245 PV 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14259NP_651532.1 JHBP 32..269 CDD:284096 67/262 (26%)
CG14661NP_001246918.1 JHBP 10..245 CDD:399529 66/259 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470414
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.