DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14259 and CG16820

DIOPT Version :10

Sequence 1:NP_651532.1 Gene:CG14259 / 43261 FlyBaseID:FBgn0039483 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_609627.1 Gene:CG16820 / 34730 FlyBaseID:FBgn0032495 Length:309 Species:Drosophila melanogaster


Alignment Length:254 Identity:50/254 - (19%)
Similarity:90/254 - (35%) Gaps:67/254 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 CRIYEPGFTKCSTNSIQKLLDQLNI-GIPEVLERFGPFDPMRVRDIVFKQDNN------------ 100
            |.:..|...:|....||....:|.. |:||.  .....||...:..:|:..|:            
  Fly    88 CSLNSPDLNECIRGLIQSFAPKLRYQGVPEF--NMDSIDPYFYKRGIFRYTNDGIQGGLLIKNME 150

  Fly   101 -------EVATIRANLTDLVVKGFANTKVKESRVSKKDFSWQTKIYLPKMRLDGRYE---MAGRI 155
                   :|.::.||.||                  ..|..:..:.||:::..|.::   ..|.:
  Fly   151 IYGISQLQVNSVAANFTD------------------NGFIIKLGVELPQLKAGGHFKADVKFGGL 197

  Fly   156 LLIPLSGSGKIFIEIDDLDILLLTKIRLYEKGGFTFDNVTAVQVQLNLSKVRTYLDNLFNGRSKE 220
            .|:|   .|...|.||::...:||...:        :.:.:.|.:|:|.::..   |:..|.:|.
  Fly   198 RLVP---KGPFNITIDNIKATILTDGHI--------EQLPSGQQRLSLHRLNA---NVNIGDAKV 248

  Fly   221 V------ERSTN----EFFNENWRDFYEALKPLIVETVENILYDVMSTVFHLIPANFFV 269
            |      :|:.|    ...|||..:......|...|....||...::..|..:|...|:
  Fly   249 VANGIFSDRNLNAMILNLVNENLPEITRVGIPATREQWAPILIAHINEFFAKVPIEKFL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14259NP_651532.1 JHBP 40..270 CDD:214779 50/254 (20%)
CG16820NP_609627.1 JHBP 79..308 CDD:214779 50/254 (20%)

Return to query results.
Submit another query.