DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14259 and CG16820

DIOPT Version :9

Sequence 1:NP_651532.1 Gene:CG14259 / 43261 FlyBaseID:FBgn0039483 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_609627.1 Gene:CG16820 / 34730 FlyBaseID:FBgn0032495 Length:309 Species:Drosophila melanogaster


Alignment Length:254 Identity:50/254 - (19%)
Similarity:90/254 - (35%) Gaps:67/254 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 CRIYEPGFTKCSTNSIQKLLDQLNI-GIPEVLERFGPFDPMRVRDIVFKQDNN------------ 100
            |.:..|...:|....||....:|.. |:||.  .....||...:..:|:..|:            
  Fly    88 CSLNSPDLNECIRGLIQSFAPKLRYQGVPEF--NMDSIDPYFYKRGIFRYTNDGIQGGLLIKNME 150

  Fly   101 -------EVATIRANLTDLVVKGFANTKVKESRVSKKDFSWQTKIYLPKMRLDGRYE---MAGRI 155
                   :|.::.||.||                  ..|..:..:.||:::..|.::   ..|.:
  Fly   151 IYGISQLQVNSVAANFTD------------------NGFIIKLGVELPQLKAGGHFKADVKFGGL 197

  Fly   156 LLIPLSGSGKIFIEIDDLDILLLTKIRLYEKGGFTFDNVTAVQVQLNLSKVRTYLDNLFNGRSKE 220
            .|:|   .|...|.||::...:||...:        :.:.:.|.:|:|.::..   |:..|.:|.
  Fly   198 RLVP---KGPFNITIDNIKATILTDGHI--------EQLPSGQQRLSLHRLNA---NVNIGDAKV 248

  Fly   221 V------ERSTN----EFFNENWRDFYEALKPLIVETVENILYDVMSTVFHLIPANFFV 269
            |      :|:.|    ...|||..:......|...|....||...::..|..:|...|:
  Fly   249 VANGIFSDRNLNAMILNLVNENLPEITRVGIPATREQWAPILIAHINEFFAKVPIEKFL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14259NP_651532.1 JHBP 32..269 CDD:284096 49/252 (19%)
CG16820NP_609627.1 JHBP 79..308 CDD:214779 50/254 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470507
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.