DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14259 and CG5945

DIOPT Version :9

Sequence 1:NP_651532.1 Gene:CG14259 / 43261 FlyBaseID:FBgn0039483 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001260439.1 Gene:CG5945 / 34729 FlyBaseID:FBgn0032494 Length:250 Species:Drosophila melanogaster


Alignment Length:264 Identity:57/264 - (21%)
Similarity:120/264 - (45%) Gaps:27/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GLLAILCL--NEIAMDRSLVSAVAYYSEKPAFLPSCRIYEPGFTKCSTNSIQKLLDQLNIGIPEV 78
            |||::|.|  :....|::      |:::    ||.|...|....:|.......|..:|..|.||:
  Fly     6 GLLSLLALGCSAAPTDKN------YFAD----LPKCSTEEDQLGECVKQLFNTLTPRLKDGNPEL 60

  Fly    79 LERFGPFDPMRVRDIVFKQDNNEVATIRANLT--DLVVKGFANTKVKESRVSKKDFSWQTKIYL- 140
              |..|::|:.:....|:..:   .|:...:|  :..:.||::.:.||  ||.|....:.|:.| 
  Fly    61 --RIEPYEPLHLNRTSFQYSS---GTVNGRITVRNAKIYGFSSNRAKE--VSVKLNGDKVKLRLV 118

  Fly   141 ---PKMRLDGRYEMAGRILLIPLSGSGKIFIEIDDLDILLLTKIRLYEKGGFTFDNVTAVQVQLN 202
               ||:.:.|.|:...::..:.|...|:..:.:.|::.:.:|...:|||.|..|..:..:..:..
  Fly   119 TQMPKLNIVGSYKADMQVNQLQLKPKGEFNVTLLDVEAITVTDGEVYEKDGHRFFRLKNIDSKPK 183

  Fly   203 LSKVRTYLDNLFNGRSKEVERSTNEFFNENWRDFYEALKPLIVETVENILYDVMSTVFHLIPANF 267
            :..:....:.:|  ...|:::......|:.|||.|..:.|...:..:.::..:.:..|.|:|.:.
  Fly   184 IKDLVIKANGIF--ADPELDKIALNVANQYWRDIYGIMLPETRQFWQPLMLRMFNEAFELVPIDQ 246

  Fly   268 FVED 271
            |:::
  Fly   247 FLKE 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14259NP_651532.1 JHBP 32..269 CDD:284096 50/242 (21%)
CG5945NP_001260439.1 JHBP 22..249 CDD:214779 51/245 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470510
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.