DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14259 and CG3246

DIOPT Version :9

Sequence 1:NP_651532.1 Gene:CG14259 / 43261 FlyBaseID:FBgn0039483 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_608781.2 Gene:CG3246 / 33564 FlyBaseID:FBgn0031538 Length:445 Species:Drosophila melanogaster


Alignment Length:228 Identity:38/228 - (16%)
Similarity:79/228 - (34%) Gaps:72/228 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VAYYSEKPAFLPSCRIYEPGFTKCSTNSIQKLLDQLNIGIPEVLERFGPFDPMRVRDIVFKQDNN 100
            |.:..|.|..||...:.:|                  :.:|.|.:..|                 
  Fly    58 VHFQQEDPQGLPGVPVPDP------------------LEVPNVKKSMG----------------- 87

  Fly   101 EVATIRANLTDLVVK--GFANTKVKESRVSKKDFSWQTKIYLPKMRLDGRYEMAG---------R 154
                 .|||....||  |.:..::.:..:..|:..:...:.|.:|.:.|:|.::.         .
  Fly    88 -----MANLDMKQVKAYGLSKFRIDKMNLDLKEMRFNGGLQLDQMLVKGQYTLSSFFSKANGPFT 147

  Fly   155 ILLIPLSGSGKIFIEIDDLDILLLTKIRLYEKGGFTFDNVTAVQVQLNLSKVRTYLDNLFNGRSK 219
            ::|..:......|:.::....|...:|::    ..||.::| :..| ||..|.:...::.||...
  Fly   148 VVLKNVYAEATAFLAVERDGQLATDRIKI----DITFSDMT-MDFQ-NLGLVGSVFQSVVNGAPN 206

  Fly   220 EVERSTNEFFNENWRDFYEALKPLIVETVENIL 252
            .|               ::|:||.:::..:..|
  Fly   207 LV---------------FDAMKPFMLQEADKKL 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14259NP_651532.1 JHBP 32..269 CDD:284096 38/228 (17%)
CG3246NP_608781.2 JHBP 31..246 CDD:214779 38/228 (17%)
Grp7_allergen 260..418 CDD:293589
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470509
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.