DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14259 and CG31207

DIOPT Version :9

Sequence 1:NP_651532.1 Gene:CG14259 / 43261 FlyBaseID:FBgn0039483 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_732581.1 Gene:CG31207 / 326125 FlyBaseID:FBgn0051207 Length:258 Species:Drosophila melanogaster


Alignment Length:230 Identity:51/230 - (22%)
Similarity:102/230 - (44%) Gaps:18/230 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PAFLPSCRIYEPGFTKCSTNSIQKLLDQLNIGIPEVLERFGPFDPMRVRDIVFKQDNNEVATIRA 107
            |..:..||.   |.:||..||:..::.....|||.:  ...|.|.:.:||..|..|    |.:.|
  Fly    23 PKEIKKCRF---GDSKCIVNSMNAIIKNYPKGIPAI--GLKPIDVVDIRDSKFWND----AMVGA 78

  Fly   108 -----NLTDLVVKGFANTKV-KESRVSKKDFSWQTKIY--LPKMRLDGRYEMAGRILLIPLSGSG 164
                 :|.:.|..||.||.: |.|...:...|...:|:  :|.:...|.|...||:.::.::.:|
  Fly    79 FWLNFDLFNQVNYGFENTTITKVSGFDENPTSSLIEIHGRIPSLIHKGDYFSMGRVWIVQMNSTG 143

  Fly   165 KIFIEIDDLDILLLTKIRLYEKGGFTFDNVTAVQVQLNLSKVRTYLDNLFNGRSKEVERSTNEFF 229
            :...:..:...:|..|:.:..:....:..:..:...:.:.:...:|||.|...: ::..:.|:.|
  Fly   144 ESLSDFQNFRFVLKLKVIMEYRNNKRYLKIYELTPFVTMDRWVFWLDNFFESNT-DMTIAINQVF 207

  Fly   230 NENWRDFYEALKPLIVETVENILYDVMSTVFHLIP 264
            |.:|.:|:..|:|..::....:...|...:|..:|
  Fly   208 NLHWVEFWNELEPTNLKIFAGVFRSVFEDIFKKVP 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14259NP_651532.1 JHBP 32..269 CDD:284096 51/230 (22%)
CG31207NP_732581.1 JHBP 7..248 CDD:284096 51/230 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470360
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.