DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14259 and dyw

DIOPT Version :9

Sequence 1:NP_651532.1 Gene:CG14259 / 43261 FlyBaseID:FBgn0039483 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_570016.1 Gene:dyw / 31252 FlyBaseID:FBgn0000092 Length:260 Species:Drosophila melanogaster


Alignment Length:273 Identity:64/273 - (23%)
Similarity:118/273 - (43%) Gaps:28/273 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GRTLLGIWSGLLAILCLNEIAMDRSLVSAVAYYSEK-PAFLPSCRIYEPGFTKCSTNSIQKLLDQ 70
            |.::..:|.|||            |.||.....||. |:.|..|::.:   ..|.....|.....
  Fly     5 GASMFLVWVGLL------------SWVSCRVDASEGFPSPLKRCKLQD---ESCLLAQAQTFFQA 54

  Fly    71 LNIGIPEVLERFGPFDPMRVRDIVFKQDNNEVATIRANLT--DLVVKGFANT-KVKESRVSKKDF 132
            ...||||  .:....:|:.: ..:|.:......:|:..||  |..:...||: .||..:...||.
  Fly    55 FKNGIPE--RQVAALEPIAL-GTMFIESGGHSESIKFKLTMSDAKLYNLANSMMVKSLKGFTKDL 116

  Fly   133 SWQTKIYL----PKMRLDGRYEMAGRILLIPLSGSGKIFIEIDDLDI-LLLTKIRLYEKGGFTFD 192
            :...|:.|    |::.:..:|::.|::|::|:...|.:.|.::|:.. :.:|...:....|.|:.
  Fly   117 TRPLKLTLLLDNPELEVRAKYDVDGKLLILPIVSKGDLTIRLNDVHTKVWITAEPVKRSDGHTYL 181

  Fly   193 NVTAVQVQLNLSKVRTYLDNLFNGRSKEVERSTNEFFNENWRDFYEALKPLIVETVENILYDVMS 257
            |:|..:....:......|.||||. :||:..||.:..|:.|......::|.|.|........::.
  Fly   182 NITDYKTATKIKGGHFDLSNLFND-NKELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQ 245

  Fly   258 TVFHLIPANFFVE 270
            :::..||.:.|.|
  Fly   246 SLWANIPYDEFFE 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14259NP_651532.1 JHBP 32..269 CDD:284096 56/245 (23%)
dywNP_570016.1 JHBP 29..258 CDD:214779 53/235 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470398
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.