DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14258 and CG17189

DIOPT Version :9

Sequence 1:NP_651531.1 Gene:CG14258 / 43260 FlyBaseID:FBgn0039482 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001356927.1 Gene:CG17189 / 43263 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster


Alignment Length:254 Identity:84/254 - (33%)
Similarity:145/254 - (57%) Gaps:8/254 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LSIVAVLLSAVEGAKYLA---EKPDFLIPCIVGDPNFNVCLTKNFQSFFRQWKDGIPGY-NAVGS 69
            :.::.:|.:.::||:.:|   |||.::..|.:.:|.|..|.|::.|:|..|...|:|.. .:.|.
  Fly     4 IGLLMLLHAGLQGAQCVAFYTEKPSYIESCKIYEPEFTKCSTRSIQAFMNQLVKGVPEIEESFGP 68

  Fly    70 FDPFYIKRVKFTQDASRSIAINADLKEVYVAGAGQALVLESSWDPNHYVARTLISVPKLRFNFDY 134
            .||...:::.|.||.|....::|:|.::.:.|.|:.|:.||......:...|.|.:|::|.:..|
  Fly    69 IDPMRQEQLVFKQDNSDVATLSANLTDMLIRGFGKMLIKESKVSKKDFSWLTKIYLPQMRIDGHY 133

  Fly   135 KVKGHVSALNLNGHGKGYFEAENALLLLELAVKPLATSDGY-FADVQSVKVNFREIKQFRIKLEN 198
            |:.|.:..:.|.|:||...|.::..:|:....: |....|| |.:|.||||.. ::.:.|.:|:|
  Fly   134 KMVGRILLVPLQGNGKIVMEIDDLDILMTTKTR-LYEKGGYTFYNVTSVKVKV-DVGKVRTRLDN 196

  Fly   199 LFGG-NKDLEDTAHILFNENWRDFFEVLRPAVEQTVGGVLLDRFKKTFVYVPATYLIKD 256
            ||.| :|::||:.:..||:||:|.||.|||.|.:||...|||...|||...||::.::|
  Fly   197 LFNGHSKEVEDSTNQFFNDNWKDVFEALRPLVVETVERTLLDLLHKTFALFPASFFVED 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14258NP_651531.1 JHBP 13..255 CDD:284096 83/247 (34%)
CG17189NP_001356927.1 JHBP 24..254 CDD:214779 79/231 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470321
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012742
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.