DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14258 and CG14259

DIOPT Version :9

Sequence 1:NP_651531.1 Gene:CG14258 / 43260 FlyBaseID:FBgn0039482 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_651532.1 Gene:CG14259 / 43261 FlyBaseID:FBgn0039483 Length:289 Species:Drosophila melanogaster


Alignment Length:251 Identity:82/251 - (32%)
Similarity:133/251 - (52%) Gaps:5/251 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LSIVAVLLSAVEGAKYLAEKPDFLIPCIVGDPNFNVCLTKNFQSFFRQWKDGIPG-YNAVGSFDP 72
            |:.:|:..|.|....|.:|||.||..|.:.:|.|..|.|.:.|....|...|||. ....|.|||
  Fly    23 LNEIAMDRSLVSAVAYYSEKPAFLPSCRIYEPGFTKCSTNSIQKLLDQLNIGIPEVLERFGPFDP 87

  Fly    73 FYIKRVKFTQDASRSIAINADLKEVYVAGAGQALVLESSWDPNHYVARTLISVPKLRFNFDYKVK 137
            ..::.:.|.||.:....|.|:|.::.|.|.....|.||......:..:|.|.:||:|.:..|::.
  Fly    88 MRVRDIVFKQDNNEVATIRANLTDLVVKGFANTKVKESRVSKKDFSWQTKIYLPKMRLDGRYEMA 152

  Fly   138 GHVSALNLNGHGKGYFEAENALLLLELAVKPLATSDGY-FADVQSVKVNFREIKQFRIKLENLFG 201
            |.:..:.|:|.||.:.|.::..:||...:: |....|: |.:|.:|:|.. .:.:.|..|:|||.
  Fly   153 GRILLIPLSGSGKIFIEIDDLDILLLTKIR-LYEKGGFTFDNVTAVQVQL-NLSKVRTYLDNLFN 215

  Fly   202 G-NKDLEDTAHILFNENWRDFFEVLRPAVEQTVGGVLLDRFKKTFVYVPATYLIKD 256
            | :|::|.:.:..||||||||:|.|:|.:.:||..:|.|.....|..:||.:.::|
  Fly   216 GRSKEVERSTNEFFNENWRDFYEALKPLIVETVENILYDVMSTVFHLIPANFFVED 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14258NP_651531.1 JHBP 13..255 CDD:284096 80/244 (33%)
CG14259NP_651532.1 JHBP 32..269 CDD:284096 78/238 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470320
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012742
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.