DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14258 and to

DIOPT Version :9

Sequence 1:NP_651531.1 Gene:CG14258 / 43260 FlyBaseID:FBgn0039482 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001287525.1 Gene:to / 43036 FlyBaseID:FBgn0039298 Length:249 Species:Drosophila melanogaster


Alignment Length:262 Identity:62/262 - (23%)
Similarity:110/262 - (41%) Gaps:36/262 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SIVAVLLSAVEGAKYLAEKPDFLIPCIVGDPNFNVCLTKNFQSFFRQ-WKDGIPGYNAVGSFDPF 73
            ::|..||.:|: ||:    |:...||..||   ..|:.|...:.|.: ..:|.||.|.: ..||.
  Fly     7 AVVLCLLVSVD-AKF----PEDPKPCKYGD---GECIMKLCNTLFSENSAEGDPGLNLM-QLDPL 62

  Fly    74 YIKRVKFTQ-DASRSIAIN-----------ADLKEVYVAGAGQALVLESSWDPNHYVARTLISVP 126
            .:.|:..:| ::|..:.|.           .|.:.|.|.|.|:.|           .|:..:.:.
  Fly    63 KVDRMVISQGESSSPVGITLTFTDNLLYGIKDQRIVKVKGFGRDL-----------TAKHEVKIV 116

  Fly   127 KLRFNF--DYKVKGHVSALNLNGHGKGYFEAENALLLLELAVKPLATSDGYFADVQSVKVNFREI 189
            ...|:.  .|.::|.|..|.::|.|:......|...::..:.|||..:...:.||..:|:..:. 
  Fly   117 TKTFSLVGPYNIQGKVLILPISGTGQSNMTMVNVRAIVSFSGKPLVKNGETYLDVTDLKITMKP- 180

  Fly   190 KQFRIKLENLFGGNKDLEDTAHILFNENWRDFFEVLRPAVEQTVGGVLLDRFKKTFVYVPATYLI 254
            :.......|||.|:|.|.|..::..|||....::....|::::.|.:.|...|..|..:|.....
  Fly   181 ESSHYHFSNLFNGDKALGDNMNVFLNENSEAIYKETAKAIDRSFGKLYLGVVKGVFSKLPYAKFF 245

  Fly   255 KD 256
            .|
  Fly   246 AD 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14258NP_651531.1 JHBP 13..255 CDD:284096 60/256 (23%)
toNP_001287525.1 JHBP 5..245 CDD:284096 61/258 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470368
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.