DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14258 and CG14661

DIOPT Version :9

Sequence 1:NP_651531.1 Gene:CG14258 / 43260 FlyBaseID:FBgn0039482 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001246918.1 Gene:CG14661 / 40611 FlyBaseID:FBgn0037288 Length:246 Species:Drosophila melanogaster


Alignment Length:267 Identity:62/267 - (23%)
Similarity:105/267 - (39%) Gaps:54/267 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KFLSIVAVLLSAVEGAKYLAEKPDFLIPCIVGDPNFNVCLTKNFQSFFRQWKDGIPGYNAVGSFD 71
            :|..|||.||............||::..|...||..:.||..:..:.......||...| |...:
  Fly     2 QFQLIVASLLICFVACISAGNMPDYIQVCHRNDPELSKCLKSSVHNLRPYLAKGIKELN-VPPLE 65

  Fly    72 PFYIKRVKFTQDASRSIAINADLKEVYVAGAGQALVLESSWDPNHYVARTLISVPKLRFNFD--- 133
            |.||..:... |.|..:.:.|  |::.:.||.           |..:.:...|....||:|:   
  Fly    66 PLYIGDLSIL-DGSAGLTVKA--KKLNILGAS-----------NFEITKLRASTQNRRFDFELIL 116

  Fly   134 --------YKVKGHVSALNLNGHG--KGYFEAENALLLLELAVKPLATSDGYFADVQSVK-VNFR 187
                    |::.|::.||.:.|:|  .|.|....|.:.::.             |::||. :.:.
  Fly   117 PHLHGDGLYEINGNILALPIKGNGPFTGNFTNFVAYVRVQY-------------DIKSVNDLEYL 168

  Fly   188 EIKQF---------RIKLENLFGGNKDLEDTAHILFNENWRDFFEVLRPAVEQTVGG---VLLDR 240
            .:|:|         .:||||||.|:|.|.|..:...|:|:..|...|...:.:.:..   |:..:
  Fly   169 HVKEFVLKIRTGKGNLKLENLFNGDKVLGDVINDTINQNFEVFTNDLIAPIARALEAKFLVITTK 233

  Fly   241 FKKTFVY 247
            ..:.|.|
  Fly   234 ILENFTY 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14258NP_651531.1 JHBP 13..255 CDD:284096 59/261 (23%)
CG14661NP_001246918.1 JHBP 10..245 CDD:399529 58/259 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470428
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.