DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14258 and CG5945

DIOPT Version :9

Sequence 1:NP_651531.1 Gene:CG14258 / 43260 FlyBaseID:FBgn0039482 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001260439.1 Gene:CG5945 / 34729 FlyBaseID:FBgn0032494 Length:250 Species:Drosophila melanogaster


Alignment Length:269 Identity:67/269 - (24%)
Similarity:107/269 - (39%) Gaps:47/269 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LSIVAVLLSAVEGAK-YLAEKPDFLIPCIVGDPNFNVCLTKNFQSFFRQWKDGIPGYNAVGSFDP 72
            ||::|:..||....| |.|:.|    .|...:.....|:.:.|.:...:.|||.|... :..::|
  Fly     8 LSLLALGCSAAPTDKNYFADLP----KCSTEEDQLGECVKQLFNTLTPRLKDGNPELR-IEPYEP 67

  Fly    73 FYIKRVKFTQDA----SRSIAINADL--------KEVYVAGAGQALVLESSWDPNHYVARTLISV 125
            .::.|..|...:    .|....||.:        |||.|...|..:.|           |.:..:
  Fly    68 LHLNRTSFQYSSGTVNGRITVRNAKIYGFSSNRAKEVSVKLNGDKVKL-----------RLVTQM 121

  Fly   126 PKLRFNFDYKVKGHVSALNLNGHGKGYFEAENALLLLELAVKPLATSDGYFADVQSVKVNFR--- 187
            |||.....||....|:.|.|.  .||.|   |..|   |.|:.:..:||...:....:. ||   
  Fly   122 PKLNIVGSYKADMQVNQLQLK--PKGEF---NVTL---LDVEAITVTDGEVYEKDGHRF-FRLKN 177

  Fly   188 -----EIKQFRIKLENLFGGNKDLEDTAHILFNENWRDFFEVLRPAVEQTVGGVLLDRFKKTFVY 247
                 :||...||...:| .:.:|:..|..:.|:.|||.:.::.|...|....::|..|.:.|..
  Fly   178 IDSKPKIKDLVIKANGIF-ADPELDKIALNVANQYWRDIYGIMLPETRQFWQPLMLRMFNEAFEL 241

  Fly   248 VPATYLIKD 256
            ||....:|:
  Fly   242 VPIDQFLKE 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14258NP_651531.1 JHBP 13..255 CDD:284096 64/262 (24%)
CG5945NP_001260439.1 JHBP 22..249 CDD:214779 61/252 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470546
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.