DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14258 and CG5867

DIOPT Version :9

Sequence 1:NP_651531.1 Gene:CG14258 / 43260 FlyBaseID:FBgn0039482 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_609625.2 Gene:CG5867 / 34728 FlyBaseID:FBgn0027586 Length:262 Species:Drosophila melanogaster


Alignment Length:280 Identity:59/280 - (21%)
Similarity:107/280 - (38%) Gaps:51/280 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VAKFLSIVAVLLSAVEGAKYLAE--------KPDFLIP-----CIVGDPNFNVCLTKNFQSFFRQ 56
            :.:...:||::|.|  |....||        ||...||     |..||.|.:.|:.:..|....:
  Fly     1 MGRIFGVVALILMA--GLCLAAEIELPPVEFKPVREIPGDIPTCREGDINISECIKQGLQQITPR 63

  Fly    57 WKDGIPGYNAVGSFDPFYIKRVKFTQDASRSIAINADLKEVYVAGAGQALVLESSWDPNHY---- 117
            .|.||...| :...|||.:.:..::. .|..:.....:|.|.:.|..:.:|     |..::    
  Fly    64 MKYGISELN-IPPLDPFEMGKSSYSY-TSGLLQGRISMKNVVIHGLSEGIV-----DKVNFRLKD 121

  Fly   118 --VARTLIS-VPKLRFNFDYKVKGHVSALNLNGHGKGYFEAENALLLLELAVKPLATSDGYFADV 179
              |...::| ||::.....||....::.|.||  .||.|.    :.:.::|::.....:.|..|.
  Fly   122 GRVRMEILSHVPQMFVEGLYKADIKLNDLKLN--PKGAFN----ITMTDVAMRARPIGELYERDG 180

  Fly   180 QSVKVNFREIKQFRIKLENLFGGNK----------DLEDTAHILFNENWRDFFEVLRPAVEQTVG 234
            .:.      ::..:::.|...|..|          .|.|......|:.||..::.:.|....|..
  Fly   181 HTY------LRLTKLETEPKVGDLKFYANGLVPDPVLNDVILDFINQYWRQLYQAMLPETLDTWQ 239

  Fly   235 GVLLDRFKKTFVYVPATYLI 254
            .::|......|..:|...|:
  Fly   240 PLILKSTNDFFAALPFDMLV 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14258NP_651531.1 JHBP 13..255 CDD:284096 58/272 (21%)
CG5867NP_609625.2 JHBP 34..260 CDD:214779 50/245 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470544
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.