DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14258 and CG31207

DIOPT Version :9

Sequence 1:NP_651531.1 Gene:CG14258 / 43260 FlyBaseID:FBgn0039482 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_732581.1 Gene:CG31207 / 326125 FlyBaseID:FBgn0051207 Length:258 Species:Drosophila melanogaster


Alignment Length:259 Identity:60/259 - (23%)
Similarity:103/259 - (39%) Gaps:39/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SIVAVLLSAVEGAKYLAEKPDFLIPCIVGDPNFNVCLTKNFQSFFRQWKDGIPGYNAVG--SFDP 72
            :|:.::|..:.|:......|..:..|..||   :.|:..:..:..:.:..|||   |:|  ..|.
  Fly     4 TIIVLVLLQIIGSLQGQILPKEIKKCRFGD---SKCIVNSMNAIIKNYPKGIP---AIGLKPIDV 62

  Fly    73 FYIKRVKFTQDAS-RSIAINADL-KEVYVAGAGQALVLESSWDPNHYVARTLIS----VPKLRFN 131
            ..|:..||..||. .:..:|.|| .:|........:...|.:|.|  ...:||.    :|.|...
  Fly    63 VDIRDSKFWNDAMVGAFWLNFDLFNQVNYGFENTTITKVSGFDEN--PTSSLIEIHGRIPSLIHK 125

  Fly   132 FDYKVKGHVSALNLNGHGKGYFEAENALLLLELAVKPLATSDGYFADVQSVKVNFREIKQFRIK- 195
            .||...|.|..:.:|..|:...:.:|...:|:|.|            :...:.|.|.:|.:.:. 
  Fly   126 GDYFSMGRVWIVQMNSTGESLSDFQNFRFVLKLKV------------IMEYRNNKRYLKIYELTP 178

  Fly   196 ----------LENLFGGNKDLEDTAHILFNENWRDFFEVLRPAVEQTVGGVLLDRFKKTFVYVP 249
                      |:|.|..|.|:....:.:||.:|.:|:..|.|...:...||....|:..|..||
  Fly   179 FVTMDRWVFWLDNFFESNTDMTIAINQVFNLHWVEFWNELEPTNLKIFAGVFRSVFEDIFKKVP 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14258NP_651531.1 JHBP 13..255 CDD:284096 59/256 (23%)
CG31207NP_732581.1 JHBP 7..248 CDD:284096 59/256 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470363
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.