DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr97Eb and Lcp65Ae

DIOPT Version :9

Sequence 1:NP_651530.1 Gene:Cpr97Eb / 43259 FlyBaseID:FBgn0039481 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_788468.1 Gene:Lcp65Ae / 45018 FlyBaseID:FBgn0020640 Length:99 Species:Drosophila melanogaster


Alignment Length:76 Identity:23/76 - (30%)
Similarity:41/76 - (53%) Gaps:10/76 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IDKHNDDG--SYTYGYEAAD---KSFKIETKYANGE-----VYGKYGYVDDQGKVREIEYGASKR 89
            |:..:|.|  ::.:.:|.:|   .:.|.:.||.|.:     |.|.:.:|.|.|:..|:.|.|.:.
  Fly    22 INLESDVGPENFQWSFETSDGQAANAKGQLKYPNTDHESLAVQGSFRFVADDGQTYEVNYIADEN 86

  Fly    90 GFEPAGSHINV 100
            ||:|.|:|:.|
  Fly    87 GFQPQGAHLPV 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr97EbNP_651530.1 Chitin_bind_4 44..91 CDD:278791 14/54 (26%)
Lcp65AeNP_788468.1 Chitin_bind_4 33..88 CDD:278791 14/54 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.