DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr97Eb and Cpr97Ea

DIOPT Version :9

Sequence 1:NP_651530.1 Gene:Cpr97Eb / 43259 FlyBaseID:FBgn0039481 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_651529.2 Gene:Cpr97Ea / 43258 FlyBaseID:FBgn0039480 Length:366 Species:Drosophila melanogaster


Alignment Length:260 Identity:98/260 - (37%)
Similarity:121/260 - (46%) Gaps:86/260 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKLTLSLGLLLLAAHSAYAQ-HQDY-------------------------TTPVPILKQIDKHN 39
            :::..|.:|.|::......:| :|||                         ..||.|||||:|||
  Fly     3 VMQRVLFVGCLIVGVGMVRSQDYQDYQENTPRTAPLRLRANAAPARAEAPRADPVAILKQINKHN 67

  Fly    40 DDGSYTYGYEAADKSFKIETKYANGEVYGKYGYVDDQGKVREIEYGASKRGFEPAGSHINVPPPT 104
            :|||||||||.||.|||||||.|.|||.|||||||:.||||.:||||:|.||:|:|..|.|.|||
  Fly    68 EDGSYTYGYEGADGSFKIETKLATGEVKGKYGYVDETGKVRVVEYGANKYGFQPSGEGITVAPPT 132

  Fly   105 LTNSNPYPLGPNELDDGQYREDPSVYYKDQKF-NRPLSPASKFSLNDFGRGQQQAYAPPPR-QPA 167
            |.             |...:|:|.  |.|:.. .||..|.         |.|:....|.|| ||.
  Fly   133 LV-------------DETLKEEPD--YADEPAPQRPQKPY---------RVQRPQPRPQPRPQPQ 173

  Fly   168 PQTPY--------------YNPTPQYYNPPAPQPRYYQPPAQNYYNPQQQQPYRGLPEQHH-PSL 217
            ||..|              |.|.||....|.|||::                   ||:||| ||:
  Fly   174 PQPQYVQYEVEEESPRRVQYAPAPQPQPQPLPQPQH-------------------LPQQHHQPSV 219

  Fly   218  217
              Fly   220  219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr97EbNP_651530.1 Chitin_bind_4 44..91 CDD:278791 35/46 (76%)
Cpr97EaNP_651529.2 Chitin_bind_4 72..119 CDD:278791 35/46 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C3BG
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D110374at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.