DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr97Eb and Cpr78E

DIOPT Version :10

Sequence 1:NP_651530.1 Gene:Cpr97Eb / 43259 FlyBaseID:FBgn0039481 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_649345.1 Gene:Cpr78E / 40408 FlyBaseID:FBgn0037114 Length:137 Species:Drosophila melanogaster


Alignment Length:132 Identity:39/132 - (29%)
Similarity:53/132 - (40%) Gaps:27/132 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLSLGLLLLAAHSAYAQHQDYTT--PVPILKQIDKHNDDGSYTYGY----------EAADKSFK 56
            |.::|.|......||...|...||  ||.||:...:.::||||.:.|          ||..::..
  Fly     5 LIVALSLCTAVVLSAPVDHVTSTTQPPVAILESSHEKHEDGSYNFSYLGEDGTHRREEAVVRNQG 69

  Fly    57 IETKYANGEVYGKYGYVDDQGKVREIEYGASKRGFEPAGSHI-------------NVPPPTLTNS 108
            .|.:|.  |:.|.|.|.|..|:...:.|.|...||.|.|..|             .||.|.|..:
  Fly    70 TENEYL--EISGSYSYFDANGQEVTVTYKADDHGFVPEGGAILPQISLAAKQVSEQVPQPDLDYA 132

  Fly   109 NP 110
            .|
  Fly   133 KP 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr97EbNP_651530.1 Chitin_bind_4 44..91 CDD:459790 14/56 (25%)
Cpr78ENP_649345.1 Chitin_bind_4 47..102 CDD:459790 14/56 (25%)

Return to query results.
Submit another query.