DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr97Eb and Cpr67Fb

DIOPT Version :10

Sequence 1:NP_651530.1 Gene:Cpr97Eb / 43259 FlyBaseID:FBgn0039481 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_648420.1 Gene:Cpr67Fb / 39225 FlyBaseID:FBgn0036110 Length:122 Species:Drosophila melanogaster


Alignment Length:103 Identity:31/103 - (30%)
Similarity:49/103 - (47%) Gaps:5/103 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKLTLSLGLLLLAAHSAYAQHQDYTTPVPILKQIDKHNDDGSYTYGYEAADKSFKIETKYANGE 65
            |:|..|.:.|.|:||..|..:.|..||     |..::...||||::.|..::.....|:.....:
  Fly     1 MIKTALIISLFLVAAIRAADESQAETT-----KYRNEIKPDGSYSWEYGTSNGIDAQESGVGGVQ 60

  Fly    66 VYGKYGYVDDQGKVREIEYGASKRGFEPAGSHINVPPP 103
            ..|...|....|...::||.|.:.|:.|.|:|:..|||
  Fly    61 AAGSVSYAAPDGTPIQLEYTADENGYRPTGAHLPTPPP 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr97EbNP_651530.1 Chitin_bind_4 44..91 CDD:459790 9/46 (20%)
Cpr67FbNP_648420.1 Chitin_bind_4 39..86 CDD:459790 9/46 (20%)

Return to query results.
Submit another query.