DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr97Eb and Cpr65Az

DIOPT Version :10

Sequence 1:NP_651530.1 Gene:Cpr97Eb / 43259 FlyBaseID:FBgn0039481 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster


Alignment Length:85 Identity:28/85 - (32%)
Similarity:40/85 - (47%) Gaps:11/85 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VPILKQIDKHNDDGSYTYGYEAAD----------KSFKIETKYANGEVYGKYGYVDDQGKVREIE 83
            :||:|...|.|.||||.|.||..:          |:..:|...|. ...|.:.|...:|:...:.
  Fly   114 IPIIKLESKVNTDGSYMYEYETGNGIKAEEMGYLKNAGVEGAEAQ-TAEGSFSYTSPEGQEISLT 177

  Fly    84 YGASKRGFEPAGSHINVPPP 103
            |.|.:.||:|.|.|:..|||
  Fly   178 YIADENGFQPQGDHLPTPPP 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr97EbNP_651530.1 Chitin_bind_4 44..91 CDD:459790 12/56 (21%)
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:459790 12/56 (21%)

Return to query results.
Submit another query.