DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr97Eb and Lcp65Ad

DIOPT Version :10

Sequence 1:NP_651530.1 Gene:Cpr97Eb / 43259 FlyBaseID:FBgn0039481 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_477278.1 Gene:Lcp65Ad / 38707 FlyBaseID:FBgn0020641 Length:108 Species:Drosophila melanogaster


Alignment Length:114 Identity:32/114 - (28%)
Similarity:50/114 - (43%) Gaps:22/114 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKLTLSLGLLLLAAHSAYAQ---HQDYTTPVPILKQIDKHNDD---GSYTYGYEAAD-KSFKIE- 58
            :|.|:::....:.|.|..|.   .||        .|:.:.:.|   ..|.:..|.:| ||.:.| 
  Fly     1 MKFTIAIAFTCILACSLAAPPAIQQD--------AQVLRFDSDVLPEGYKFAVETSDGKSHQEEG 57

  Fly    59 ------TKYANGEVYGKYGYVDDQGKVREIEYGASKRGFEPAGSHINVP 101
                  |.:....|.|.|.||.|.|:...|:|.|.:.||:|.|:|:..|
  Fly    58 QLKDVGTDHEAIVVRGSYAYVGDDGQTYSIQYLADENGFQPEGAHLPRP 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr97EbNP_651530.1 Chitin_bind_4 44..91 CDD:459790 17/54 (31%)
Lcp65AdNP_477278.1 Chitin_bind_4 41..96 CDD:459790 17/54 (31%)

Return to query results.
Submit another query.