DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr97Eb and Cpr65Aw

DIOPT Version :10

Sequence 1:NP_651530.1 Gene:Cpr97Eb / 43259 FlyBaseID:FBgn0039481 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster


Alignment Length:117 Identity:29/117 - (24%)
Similarity:50/117 - (42%) Gaps:15/117 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKLTLSLGLLLLAAHSAYAQHQDYTTPVPILKQIDKHNDDGSYTYGYEAADKSFKIE------- 58
            |..|||..||:|:   |..|...:.|....||:..:::.|...|.:.:|.:|...:.|       
  Fly     1 MAGLTLLFGLILV---SFCACSSNATDTAQILRYDNENMDSDGYAFSFETSDGISREERATLKNP 62

  Fly    59 -TKYANGEVYGKYGYVDDQGKVREIEYGASKRGFEPAGSHINVPPPTLTNSN 109
             |......:.|...:|...|...::.|.|.:.||:..|.|:    |.:.:|:
  Fly    63 GTPEEAIAIQGSVHWVGPDGIHYKLNYLADENGFQAQGEHL----PQVEHSS 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr97EbNP_651530.1 Chitin_bind_4 44..91 CDD:459790 10/54 (19%)
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:459790 10/54 (19%)

Return to query results.
Submit another query.