DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr97Eb and Cpr49Ab

DIOPT Version :10

Sequence 1:NP_651530.1 Gene:Cpr97Eb / 43259 FlyBaseID:FBgn0039481 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_610769.1 Gene:Cpr49Ab / 36345 FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster


Alignment Length:89 Identity:27/89 - (30%)
Similarity:40/89 - (44%) Gaps:14/89 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ILKQIDKHNDDGSYTYGYEA-----ADKSFKIE--TKYANGEVYGKYGYVDDQGKVREIEYGASK 88
            |::|.|....|| |.|.:|.     .::|.:||  |:.......|.|.|....|.:..::|.|..
  Fly   161 IIRQEDDVEVDG-YHYLWETENGILGEESGRIEKLTEEEGLRSKGFYEYTGPDGILYRVDYVADD 224

  Fly    89 RGFEPAGSHI-NVPPPTLTNSNPY 111
            .||.|:.:|: ..|||.     ||
  Fly   225 NGFVPSAAHLPTAPPPP-----PY 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr97EbNP_651530.1 Chitin_bind_4 44..91 CDD:459790 13/53 (25%)
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:459790 13/53 (25%)

Return to query results.
Submit another query.