DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr97Eb and Cpr47Ed

DIOPT Version :10

Sequence 1:NP_651530.1 Gene:Cpr97Eb / 43259 FlyBaseID:FBgn0039481 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_610658.1 Gene:Cpr47Ed / 36192 FlyBaseID:FBgn0033601 Length:127 Species:Drosophila melanogaster


Alignment Length:109 Identity:38/109 - (34%)
Similarity:54/109 - (49%) Gaps:12/109 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKLTLSL-GLLLLAAHSAYAQHQDYTTPVPILKQIDKHNDDGSYTYGYEAADKSFKIE------ 58
            |..|.|.| |..||  .|..|:......||||||.:.:....|||.:.:|:||.:::.|      
  Fly     1 MFALLLILTGCQLL--WSCPAECTSINVPVPILKSVTEQLSSGSYLFSFESADGTYREELGIVSS 63

  Fly    59 ---TKYANGEVYGKYGYVDDQGKVREIEYGASKRGFEPAGSHIN 99
               |...:.||.|.|.|::|.|:..|:.|.|.|.||.|...:|:
  Fly    64 DSKTSDDDLEVSGIYRYINDWGQEVEVRYTADKNGFLPHVRYIS 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr97EbNP_651530.1 Chitin_bind_4 44..91 CDD:459790 17/55 (31%)
Cpr47EdNP_610658.1 Chitin_bind_4 43..99 CDD:459790 17/55 (31%)

Return to query results.
Submit another query.