DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr97Eb and Cpr12A

DIOPT Version :10

Sequence 1:NP_651530.1 Gene:Cpr97Eb / 43259 FlyBaseID:FBgn0039481 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_572896.1 Gene:Cpr12A / 32309 FlyBaseID:FBgn0030494 Length:173 Species:Drosophila melanogaster


Alignment Length:117 Identity:30/117 - (25%)
Similarity:45/117 - (38%) Gaps:8/117 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TLSLGLLLLAAHSAYAQHQDYTTP-VPILKQIDKHNDDGSYTYGYEAADKSFKIETKY------- 61
            ::...:.||:|....||....:.| ..:|.:.|....||||.|.:|..|.:.:.|..|       
  Fly     6 SILFAIFLLSATLISAQQIKESAPSARLLDRFDNRYPDGSYEYRFELDDGTARYERGYFVKINDV 70

  Fly    62 ANGEVYGKYGYVDDQGKVREIEYGASKRGFEPAGSHINVPPPTLTNSNPYPL 113
            ....|.|.|.|....|:...:.|.|.:.|:....|......|.|..|...|:
  Fly    71 KTLMVVGYYAYRMTDGRYITVFYNADQFGYRQNQSITPQEYPNLPRSIEVPM 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr97EbNP_651530.1 Chitin_bind_4 44..91 CDD:459790 13/53 (25%)
Cpr12ANP_572896.1 Chitin_bind_4 46..100 CDD:459790 13/53 (25%)

Return to query results.
Submit another query.