DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr97Eb and CG15754

DIOPT Version :10

Sequence 1:NP_651530.1 Gene:Cpr97Eb / 43259 FlyBaseID:FBgn0039481 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_572894.1 Gene:CG15754 / 32307 FlyBaseID:FBgn0030492 Length:281 Species:Drosophila melanogaster


Alignment Length:122 Identity:30/122 - (24%)
Similarity:46/122 - (37%) Gaps:40/122 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 QHQDYTTPVP------------ILK-----QIDKH--------------NDDGSYTYGYEAADKS 54
            :.|:..||.|            :|:     |:|:.              |:||||.:||......
  Fly   144 EEQEEATPQPQPLPPALPQPGGVLEELAGGQVDEELEDYNAWRDNFYELNEDGSYIFGYSIPHGI 208

  Fly    55 FKIETKYANGEVYGKY---GYV----DDQGKVREIE-YGASKRGFEPAG-SHINVPP 102
            .:.|..|.:.|.:|:.   .||    |.||...|:. |.|...|::|.. ..:..||
  Fly   209 RRWEKGYYSEEQHGRVVEGFYVQPRHDSQGLRYELRCYRADSEGYQPRPVEFLRTPP 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr97EbNP_651530.1 Chitin_bind_4 44..91 CDD:459790 15/54 (28%)
CG15754NP_572894.1 None

Return to query results.
Submit another query.