DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr97Eb and Cpr11A

DIOPT Version :9

Sequence 1:NP_651530.1 Gene:Cpr97Eb / 43259 FlyBaseID:FBgn0039481 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_572803.1 Gene:Cpr11A / 32198 FlyBaseID:FBgn0030394 Length:270 Species:Drosophila melanogaster


Alignment Length:287 Identity:56/287 - (19%)
Similarity:73/287 - (25%) Gaps:120/287 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKLTLSLGLLLLAAHSA------------YAQHQDYTTPVPILKQIDKHNDD------------ 41
            |....:.||...|||...            |.....||.|..|       :||            
  Fly     1 MKSFLILLGFAALAAADVKHLTDRNLDLFKYNPSDIYTLPEDI-------DDDKPAVHFSGDVMK 58

  Fly    42 ------GSYTYGYEAADKSFKIETKYANG---------------EVYGKYGYVDDQGKVREIEYG 85
                  .:|..|     |.||:|.|..||               .|.|.|.:....||..:..|.
  Fly    59 AKTETLQNYNSG-----KKFKLELKTQNGIEVSSVGKLKDDKTFVVSGSYSFTGADGKRYKTRYT 118

  Fly    86 ASKRGFEP----------------AGSHINVPPPTLT-NSNPYPLGPNELDDGQYREDP----SV 129
            |.:.|:.|                ||....|.|.:|. |.|.:......||..|..:.|    ..
  Fly   119 ADEFGYHPITELDLDIPEPQPLASAGQRQTVDPSSLLGNKNRFQFLQQTLDSDQGSQGPLRGSGQ 183

  Fly   130 YYKDQKFNRPLSPASKFSL-------------------------------------NDFGRGQQQ 157
            ...|..:..|....:.:..                                     |.:|.|...
  Fly   184 SGDDYSYTSPYGNGNAYGNGVGNGYGNGVGNGYGNGVGNGQGNGAGNAYGNGNGVGNGYGNGNGN 248

  Fly   158 AYAPPPRQPAPQTPYYNPTPQYYNPPA 184
            .|...|    ||.|...|: :.|.|.|
  Fly   249 GYDYQP----PQVPLATPS-RLYLPTA 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr97EbNP_651530.1 Chitin_bind_4 44..91 CDD:278791 16/61 (26%)
Cpr11ANP_572803.1 Chitin_bind_4 73..124 CDD:278791 13/50 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.