powered by:
Protein Alignment Cpr97Ea and Cpr65Ay
DIOPT Version :9
Sequence 1: | NP_651529.2 |
Gene: | Cpr97Ea / 43258 |
FlyBaseID: | FBgn0039480 |
Length: | 366 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001097524.1 |
Gene: | Cpr65Ay / 5740348 |
FlyBaseID: | FBgn0085300 |
Length: | 109 |
Species: | Drosophila melanogaster |
Alignment Length: | 58 |
Identity: | 20/58 - (34%) |
Similarity: | 28/58 - (48%) |
Gaps: | 1/58 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 64 NKHNEDGSYTYGYEGADGSFKIETKLATGEVKGKYGYVDETGKVRVVEYGANKYGFQP 121
::.||..:||...|......::.|:... |.||.|.::...|....|.|.|||.||||
Fly 41 HQRNEAITYTVKPETVQDPKEVTTQKPV-EYKGGYSFISADGYEYQVLYKANKNGFQP 97
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10380 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.