DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr97Ea and CG15515

DIOPT Version :10

Sequence 1:NP_651529.2 Gene:Cpr97Ea / 43258 FlyBaseID:FBgn0039480 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001263088.1 Gene:CG15515 / 43538 FlyBaseID:FBgn0039719 Length:123 Species:Drosophila melanogaster


Alignment Length:98 Identity:25/98 - (25%)
Similarity:37/98 - (37%) Gaps:16/98 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 TAPLRLRANAAPARAEAPRAD---PVAILKQINKHNEDGSYTYGYEGADGSFKIETKLATGE--- 93
            ||.:.|.|    |.:.|...|   |..:.:..|:......|.:..|..:||.:.|..:....   
  Fly    10 TALVALMA----AHSSAGLLDYVFPTIVSEYYNQAPTKEGYRFASEEPNGSKREEMGVIMNPGTP 70

  Fly    94 -----VKGKYGYVDE-TGKVRVVEYGANKYGFQ 120
                 |.|.|...|| |....|..|.|:|.|::
  Fly    71 DEQLVVMGMYSSYDEKTDTETVTMYTADKDGYK 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr97EaNP_651529.2 Chitin_bind_4 72..119 CDD:459790 15/55 (27%)
CG15515NP_001263088.1 None

Return to query results.
Submit another query.