DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr97Ea and Cpr78E

DIOPT Version :10

Sequence 1:NP_651529.2 Gene:Cpr97Ea / 43258 FlyBaseID:FBgn0039480 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_649345.1 Gene:Cpr78E / 40408 FlyBaseID:FBgn0037114 Length:137 Species:Drosophila melanogaster


Alignment Length:105 Identity:34/105 - (32%)
Similarity:53/105 - (50%) Gaps:12/105 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PVAILKQINKHNEDGSYTYGYEGADGSFKIETKLATG--------EVKGKYGYVDETGKVRVVEY 112
            |||||:..::.:|||||.:.|.|.||:.:.|..:...        |:.|.|.|.|..|:...|.|
  Fly    31 PVAILESSHEKHEDGSYNFSYLGEDGTHRREEAVVRNQGTENEYLEISGSYSYFDANGQEVTVTY 95

  Fly   113 GANKYGFQPSGEG----ITVAPPTLVDETLKEEPDYADEP 148
            .|:.:||.|.|..    |::|...:.::..:.:.|||..|
  Fly    96 KADDHGFVPEGGAILPQISLAAKQVSEQVPQPDLDYAKPP 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr97EaNP_651529.2 Chitin_bind_4 72..119 CDD:459790 15/54 (28%)
Cpr78ENP_649345.1 Chitin_bind_4 47..102 CDD:459790 15/54 (28%)

Return to query results.
Submit another query.