DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr97Ea and Cpr65Ea

DIOPT Version :10

Sequence 1:NP_651529.2 Gene:Cpr97Ea / 43258 FlyBaseID:FBgn0039480 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_648075.1 Gene:Cpr65Ea / 38773 FlyBaseID:FBgn0035735 Length:127 Species:Drosophila melanogaster


Alignment Length:101 Identity:32/101 - (31%)
Similarity:45/101 - (44%) Gaps:2/101 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 APRADPVAILKQINKHNEDGSYTYGYEGADGSFKIETKLATGEVKGKYGYVDETGKVRVVEYGAN 115
            ||..|. .|.|.:...:.||:|.|..|.|.|....|..||..|..|.|.|:...|....|.|.|:
  Fly    17 APLNDD-TITKFLANQDTDGTYAYDIEQASGIQIKEEGLAGHEAHGSYSYISPEGIPVQVVYTAD 80

  Fly   116 KYGFQPSGEGITVAPPTLVDETLKEEPDYADEPAPQ 151
            ::||.|. ..:...||.:.:|.|:......:.|.|:
  Fly    81 EFGFHPQ-SNLLPTPPPIPEEILRSIRYIQEHPTPE 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr97EaNP_651529.2 Chitin_bind_4 72..119 CDD:459790 16/46 (35%)
Cpr65EaNP_648075.1 Chitin_bind_4 37..84 CDD:459790 16/46 (35%)

Return to query results.
Submit another query.