DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr97Ea and Acp65Aa

DIOPT Version :10

Sequence 1:NP_651529.2 Gene:Cpr97Ea / 43258 FlyBaseID:FBgn0039480 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster


Alignment Length:85 Identity:20/85 - (23%)
Similarity:40/85 - (47%) Gaps:8/85 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ARAEAPRADPVAILKQINKHNEDGSYTYGYEGADGSFKIETKLATG--------EVKGKYGYVDE 103
            |.|.|...:.|.:|:..:::...|.|.:.|:.:||:.:.|..:...        .::|...:|..
  Fly    16 ALASARPQNDVEVLEYESENTGLGGYKFSYKLSDGTSRTEEGVVNNAGTDNESISIRGSVTWVAP 80

  Fly   104 TGKVRVVEYGANKYGFQPSG 123
            .|:...:.:.|::.||||.|
  Fly    81 DGQTYTINFVADENGFQPEG 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr97EaNP_651529.2 Chitin_bind_4 72..119 CDD:459790 9/54 (17%)
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:459790 9/54 (17%)

Return to query results.
Submit another query.