DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr97Ea and Lcp65Ad

DIOPT Version :10

Sequence 1:NP_651529.2 Gene:Cpr97Ea / 43258 FlyBaseID:FBgn0039480 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_477278.1 Gene:Lcp65Ad / 38707 FlyBaseID:FBgn0020641 Length:108 Species:Drosophila melanogaster


Alignment Length:83 Identity:27/83 - (32%)
Similarity:42/83 - (50%) Gaps:13/83 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 ADPVAILK--QINKHNED---GSYTYGYEGADG-SFKIETKL---ATGE----VKGKYGYVDETG 105
            |.|.||.:  |:.:.:.|   ..|.:..|.:|| |.:.|.:|   .|..    |:|.|.||.:.|
  Fly    18 AAPPAIQQDAQVLRFDSDVLPEGYKFAVETSDGKSHQEEGQLKDVGTDHEAIVVRGSYAYVGDDG 82

  Fly   106 KVRVVEYGANKYGFQPSG 123
            :...::|.|::.||||.|
  Fly    83 QTYSIQYLADENGFQPEG 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr97EaNP_651529.2 Chitin_bind_4 72..119 CDD:459790 16/54 (30%)
Lcp65AdNP_477278.1 Chitin_bind_4 41..96 CDD:459790 16/54 (30%)

Return to query results.
Submit another query.