DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr97Ea and Cpr49Af

DIOPT Version :10

Sequence 1:NP_651529.2 Gene:Cpr97Ea / 43258 FlyBaseID:FBgn0039480 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_610775.1 Gene:Cpr49Af / 36352 FlyBaseID:FBgn0033729 Length:126 Species:Drosophila melanogaster


Alignment Length:105 Identity:35/105 - (33%)
Similarity:47/105 - (44%) Gaps:11/105 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LRLRANAAPARAEAPRADPVAILKQINKHNEDGSYTYGYEGADGS-------FKIETKLATGE-V 94
            |.|.|....|.:.....||::   |.:....:|.|.|.||..|||       .|.......|| |
  Fly     4 LMLIALFVVAASATDNDDPIS---QESNVEYNGKYHYHYELKDGSKATQDGVLKSVNADHNGESV 65

  Fly    95 KGKYGYVDETGKVRVVEYGANKYGFQPSGEGITVAPPTLV 134
            .|||.:|.:.||..||.|.|::.|:...|:.:...|||.|
  Fly    66 NGKYSFVADDGKTYVVSYTADENGYLAVGDHLPTPPPTPV 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr97EaNP_651529.2 Chitin_bind_4 72..119 CDD:459790 21/54 (39%)
Cpr49AfNP_610775.1 Chitin_bind_4 35..90 CDD:459790 21/54 (39%)

Return to query results.
Submit another query.