DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr97Ea and Cpr47Ed

DIOPT Version :10

Sequence 1:NP_651529.2 Gene:Cpr97Ea / 43258 FlyBaseID:FBgn0039480 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_610658.1 Gene:Cpr47Ed / 36192 FlyBaseID:FBgn0033601 Length:127 Species:Drosophila melanogaster


Alignment Length:97 Identity:31/97 - (31%)
Similarity:47/97 - (48%) Gaps:18/97 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PVAILKQINKHNEDGSYTYGYEGADGSFKIETKLATG---------EVKGKYGYVDETGKVRVVE 111
            ||.|||.:.:....|||.:.:|.|||:::.|..:.:.         ||.|.|.|:::.|:...|.
  Fly    27 PVPILKSVTEQLSSGSYLFSFESADGTYREELGIVSSDSKTSDDDLEVSGIYRYINDWGQEVEVR 91

  Fly   112 YGANKYGFQP------SGEG---ITVAPPTLV 134
            |.|:|.||.|      .||.   |.:.|..|:
  Fly    92 YTADKNGFLPHVRYISKGEAYKPIRIEPLALM 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr97EaNP_651529.2 Chitin_bind_4 72..119 CDD:459790 16/55 (29%)
Cpr47EdNP_610658.1 Chitin_bind_4 43..99 CDD:459790 16/55 (29%)

Return to query results.
Submit another query.