DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr97Ea and Cpr47Ec

DIOPT Version :10

Sequence 1:NP_651529.2 Gene:Cpr97Ea / 43258 FlyBaseID:FBgn0039480 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_610657.1 Gene:Cpr47Ec / 36191 FlyBaseID:FBgn0033600 Length:131 Species:Drosophila melanogaster


Alignment Length:112 Identity:42/112 - (37%)
Similarity:53/112 - (47%) Gaps:14/112 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PRADPVAILKQINKHNEDGSYTYGYEGADG------SFKIE--TKLATGEVKGKYGYVDETGKVR 108
            |..:||||||......|:| ||..|.||||      :|.::  |.....||||.|.|::|.|:..
  Fly    24 PEREPVAILKSEIIKTEEG-YTSAYVGADGISRNEEAFLVDKGTDEEALEVKGSYKYINEDGQEV 87

  Fly   109 VVEYGANKYGFQPSGEGITVAPP--TLVDETLKEEPDYADEPAPQRP 153
            .|.|.|.|.||.|.|   ::..|  |.|.|..|:.|.........||
  Fly    88 EVFYTAGKNGFVPYG---SIINPEITAVAEAAKDLPKVEKVEKAGRP 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr97EaNP_651529.2 Chitin_bind_4 72..119 CDD:459790 21/54 (39%)
Cpr47EcNP_610657.1 Chitin_bind_4 43..98 CDD:459790 21/54 (39%)

Return to query results.
Submit another query.