DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr97Ea and Cpr12A

DIOPT Version :9

Sequence 1:NP_651529.2 Gene:Cpr97Ea / 43258 FlyBaseID:FBgn0039480 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_572896.1 Gene:Cpr12A / 32309 FlyBaseID:FBgn0030494 Length:173 Species:Drosophila melanogaster


Alignment Length:191 Identity:43/191 - (22%)
Similarity:62/191 - (32%) Gaps:55/191 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 NAAPARAEAPRADPVAILKQINKHNEDGSYTYGYEGADGSFKIE-------TKLATGEVKGKYGY 100
            :|...:..||.|   .:|.:.:....||||.|.:|..||:.:.|       ..:.|..|.|.|.|
  Fly    20 SAQQIKESAPSA---RLLDRFDNRYPDGSYEYRFELDDGTARYERGYFVKINDVKTLMVVGYYAY 81

  Fly   101 VDETGKVRVVEYGANKYGFQPSGEGITVAPPTLVDETLKEEPDYADEPAPQR-PQKPYRVQRPQP 164
            ....|:...|.|.|:::|:: ..:.||                      ||. |..|..::.|. 
  Fly    82 RMTDGRYITVFYNADQFGYR-QNQSIT----------------------PQEYPNLPRSIEVPM- 122

  Fly   165 RPQPRPQPQPQPQYVQYEVEEESPRRVQYAPAPQPQPQPLPQPQHLPQQHHQPSVGPAPPR 225
                              |.|.|............|.|  .|.|.....|..||:....||
  Fly   123 ------------------VSEASAASAASDGVSSSQFQ--SQFQSRLDAHGNPSITTTTPR 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr97EaNP_651529.2 Chitin_bind_4 72..119 CDD:278791 15/53 (28%)
Cpr12ANP_572896.1 Chitin_bind_4 46..100 CDD:278791 15/53 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.