DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spz and spz5

DIOPT Version :9

Sequence 1:NP_524526.1 Gene:spz / 43256 FlyBaseID:FBgn0003495 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_647753.1 Gene:spz5 / 38350 FlyBaseID:FBgn0035379 Length:387 Species:Drosophila melanogaster


Alignment Length:208 Identity:49/208 - (23%)
Similarity:83/208 - (39%) Gaps:48/208 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 QRTDTEVQSEQPIPPRHPSDTFVFPDSPIAKYRPPQSPARPLRNDTKE----HNPCAKDESQHLR 181
            ||...|||:|                           ...|:...|:|    .|| |:|..|..|
  Fly   220 QRQPDEVQAE---------------------------VVEPVNEQTEEAEEQDNP-AEDHPQSKR 256

  Fly   182 NFCTNVDDYPDLSGLTHKLKNNFAKFFSNDLQPTDVSSRVGGSDERFLCRSIRKLVYPKKGLRAD 246
            :...|: |..|:.|:  :..|...|......|....|:         ||::..:.:.|:..|.:.
  Fly   257 DVSLNM-DLLDIVGV--EAPNPLKKRSRTKRQSPGRST---------LCQTTSQFITPQAALNSR 309

  Fly   247 DTWQLIVN-NDEYKQAIQIEECEGADQPCDFAANFPQSYNPICKQHYTQQTLASIKSDGELDVVQ 310
            ..|..:|| .:..:|.::.|.|  |...|......|..||..|:|.:.|:.|.:::.:|: ::..
  Fly   310 GNWMFVVNEQNTARQMVKAELC--ASNTCSNLCELPNGYNSRCEQKFVQKRLIALQGNGQ-NLYT 371

  Fly   311 NSFKIPSCCKCAL 323
            ::|..||||.|.:
  Fly   372 DTFWFPSCCVCTI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spzNP_524526.1 Spaetzle 228..321 CDD:292695 25/93 (27%)
spz5NP_647753.1 Spaetzle 291..382 CDD:292695 25/102 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438886
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23199
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.