DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RYa-R and QRFPR

DIOPT Version :9

Sequence 1:NP_001287552.1 Gene:RYa-R / 43253 FlyBaseID:FBgn0004842 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_937822.2 Gene:QRFPR / 84109 HGNCID:15565 Length:431 Species:Homo sapiens


Alignment Length:444 Identity:109/444 - (24%)
Similarity:183/444 - (41%) Gaps:116/444 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 DYDLLSEDMWSSAYFKIIVYMLYIP-------------IFIFALIGNGTVCYIVYSTPRMRTVTN 141
            |::|..|...:....:.:||...:|             ||..||.||..|.|:|..:..||||||
Human    17 DHNLTREQFIALYRLRPLVYTPELPGRAKLALVLTGVLIFALALFGNALVFYVVTRSKAMRTVTN 81

  Fly   142 YFIASLAIGDILMSFFCVPSSFISLFILNYWPFGLALCHFVNYSQAVSVLVSAYTLVAISIDRYI 206
            .||.|||:.|:|::|||:|.:.:. .|.:.|..|..:|..|.:.|:.:|:....|:..|:::|:.
Human    82 IFICSLALSDLLITFFCIPVTMLQ-NISDNWLGGAFICKMVPFVQSTAVVTEILTMTCIAVERHQ 145

  Fly   207 AIMWPLKPR--ITKRYATFIIAGVWFIALATALPIPIVSGLDIPMSPWHTKCEKYICREMWPSRT 269
            .::.|.|.:  .|.|.|..::..||.:|:....|:..|..|:|.....:.| |...|.|.|.|..
Human   146 GLVHPFKMKWQYTNRRAFTMLGVVWLVAVIVGSPMWHVQQLEIKYDFLYEK-EHICCLEEWTSPV 209

  Fly   270 QEYYYTLSLFALQFVVPLGVLIFTYARITIRVWAKRPPGEAETNRD------QRMARSKRKMVKM 328
            .:..||..:..:.|::||.|::..|::|...:|.|:..|:....|.      .::||.|::.|.|
Human   210 HQKIYTTFILVILFLLPLMVMLILYSKIGYELWIKKRVGDGSVLRTIHGKEMSKIARKKKRAVIM 274

  Fly   329 MLTVVIVFTCCWLPFNILQLLLNDEEF-AHWD--PLPYVWFAFHWLAMSHCCYNPIIYCYMNARF 390
            |:|||.:|..||.||:::.:::....| ..:|  .:..::.....:..|:...|||:|.:||..|
Human   275 MVTVVALFAVCWAPFHVVHMMIEYSNFEKEYDDVTIKMIFAIVQIIGFSNSICNPIVYAFMNENF 339

  Fly   391 RSGFVQLMHRMPGLRRWCCLRSVGDRMNATSGEMTTKYHRHVGDALFRKPKICIRNGSSTSSQSN 455
                                                                             
Human   340 ----------------------------------------------------------------- 339

  Fly   456 EHIHHLHQRSSKATSDIFASEPIIVRRDVTTAVAVISKNKTDSPVRRSGSSGGT 509
                                     :::|.:||.....|||.||.:|.|:||.|
Human   340 -------------------------KKNVLSAVCYCIVNKTFSPAQRHGNSGIT 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RYa-RNP_001287552.1 7tm_4 113..>234 CDD:304433 45/135 (33%)
7tm_1 122..383 CDD:278431 82/271 (30%)
QRFPRNP_937822.2 7tm_1 62..332 CDD:278431 82/271 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147361
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3897
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.