DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RYa-R and TACR2

DIOPT Version :9

Sequence 1:NP_001287552.1 Gene:RYa-R / 43253 FlyBaseID:FBgn0004842 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_001048.2 Gene:TACR2 / 6865 HGNCID:11527 Length:398 Species:Homo sapiens


Alignment Length:378 Identity:128/378 - (33%)
Similarity:197/378 - (52%) Gaps:44/378 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 SGLQFETYNITVMMNFSCDDYDLLSEDMWSSAYFKIIVYMLYIPIFIFALIGNGTVCYIVYSTPR 135
            ||.:..|..||.   ||...:.|.   :|::||..::         :.|:.||..|.:|:.:..|
Human    14 SGPESNTTGITA---FSMPSWQLA---LWATAYLALV---------LVAVTGNAIVIWIILAHRR 63

  Fly   136 MRTVTNYFIASLAIGDILMSFFCVPSSFISLFILNYWPFGLALCHFVNYSQAVSVLVSAYTLVAI 200
            |||||||||.:||:.|:.|:.|....:|: ....|.|.||.|.|:|.|.....::.||.|::.||
Human    64 MRTVTNYFIVNLALADLCMAAFNAAFNFV-YASHNIWYFGRAFCYFQNLFPITAMFVSIYSMTAI 127

  Fly   201 SIDRYIAIMWPLKPRITKRYATFIIAGVWFIALATALPIPIVSGLDIPMSPWHTKCEKYICREMW 265
            :.|||:||:.|.:||::......:|||:|.:|||.|.|....|  .:.|....|||.     ..|
Human   128 AADRYMAIVHPFQPRLSAPSTKAVIAGIWLVALALASPQCFYS--TVTMDQGATKCV-----VAW 185

  Fly   266 P----SRTQEYYYTLSLFALQFVVPLGVLIFTYARITIRVWAKRPPGEAETNRDQRMARSKRKMV 326
            |    .:|...|: |.:.||.:.:||.|:...|:.|.:.:|.:..||......:.|..::.:|.|
Human   186 PEDSGGKTLLLYH-LVVIALIYFLPLAVMFVAYSVIGLTLWRRAVPGHQAHGANLRHLQAMKKFV 249

  Fly   327 KMMLTVVIVFTCCWLPFNILQLL--LNDEEFAHWDPLPYVWFAFHWLAMSHCCYNPIIYCYMNAR 389
            |.|:.||:.|..||||:::..:|  ..::.:.| ..:..|:.|..|||||...|||||||.:|.|
Human   250 KTMVLVVLTFAICWLPYHLYFILGSFQEDIYCH-KFIQQVYLALFWLAMSSTMYNPIIYCCLNHR 313

  Fly   390 FRSGFVQLMHRMPGLRRWCC---LRSVGDRMNAT-SGEMTTKYHR-HVGDALF 437
            ||||| :|..|       ||   ..:..|::..| :..::|:.:| |..:.||
Human   314 FRSGF-RLAFR-------CCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLF 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RYa-RNP_001287552.1 7tm_4 113..>234 CDD:304433 47/120 (39%)
7tm_1 122..383 CDD:278431 95/266 (36%)
TACR2NP_001048.2 7tm_4 42..>168 CDD:304433 51/135 (38%)
7tm_1 50..307 CDD:278431 95/266 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D314830at33208
OrthoFinder 1 1.000 - - FOG0000620
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.